From: Voluspa <lista1@telia.com>
To: linux-kernel@vger.kernel.org
Subject: Re: 2.5.75 does not boot - TCQ oops
Date: Sat, 12 Jul 2003 06:05:06 +0200 [thread overview]
Message-ID: <20030712060506.0b152432.lista1@telia.com> (raw)
On 2003-07-11 20:58:09 Ivan Gyurdiev wrote:
> Patch confirmed to work - the machine boots.
[...]
> Most massive fs corruption I've ever had.
[...]
> I blamed the reiserfs bk work at first (which I applied along with
> [Axboe's] tcq patch), but I noted that the fs only gets corrupted
> with a tcq-enabled kernel
I took home 2.5.75-bk1, applied the tcq patch and then used the computer
for five hours in the TCQ+TASKFILE environment. Filesystem is ext2.
Untarred a kernel. Copied it to a couple of destinations. Compiled.
Listened to music. Watched part of a movie. Did a nfs move of a file
(which by the way was a pure horror... 600k in ca 3 minutes) from a
machine with a 2.2.16 kernel. Then read about your woes.
Checked the md5sum of a large file that I keep for... corruption checks.
Was ok. Did a read massage by "cd /usr ; find . -type f -exec md5sum {}
\;". No hickups. Except...
Found 1 error in /var/log/kernel that I _never_ get with the 2.4.19:
Jul 12 02:03:39 loke kernel: hda: status error: status=0x48 { DriveReady
DataRequest }
Jul 12 02:03:39 loke kernel:
Jul 12 02:03:39 loke kernel: hda: drive not ready for command
So I shut down X in preparation for a reboot and full fs check, waiting
for the distributed project foldingathome to checkpoint its work, and
there was another never experienced error (time is UTC):
[01:10:00] [SPG] 100.0 %
[01:10:00] [SPG] Writing current.xyz
[01:10:01] [SPG] Sequence 15 completed:
[01:10:01] SNEYSGTFSFKTKQSKDEMLDALQIKNSYISQMRQITPKMAIEYPKGTPT . . .
[01:10:01] - Error: Checksums don't match (work/wudata_06.arc)
[01:10:01] [SPG] Error: checksum error
[01:10:02] CoreStatus = 0 (0)
[01:10:02] Client-core communications error: ERROR 0x0
[01:10:02] Deleting current work unit & continuing...
The reboot didn't reveal any fs corruption. Still, I've returned to a
safe kernel :-) Disk where TCQ was enabled (using depth 8)
is a IBM-DTLA-307015. Unfortunately, or luckily, my
IC35L080AVVA07-0 shares its life with a CD, so no TCQ there.
Mvh
Mats Johannesson
next reply other threads:[~2003-07-12 3:49 UTC|newest]
Thread overview: 12+ messages / expand[flat|nested] mbox.gz Atom feed top
2003-07-12 4:05 Voluspa [this message]
-- strict thread matches above, loose matches on Subject: below --
2003-07-12 10:46 Ivan Gyurdiev
2003-07-12 13:07 ` Voluspa
2003-07-12 7:51 Ivan Gyurdiev
2003-07-11 8:35 Voluspa
2003-07-11 2:51 Ivan Gyurdiev
2003-07-11 8:03 ` Jens Axboe
2003-07-11 8:28 ` Jens Axboe
2003-07-11 8:34 ` Jens Axboe
2003-07-11 10:54 ` Bartlomiej Zolnierkiewicz
2003-07-11 10:55 ` Jens Axboe
2003-07-11 20:58 ` Ivan Gyurdiev
Reply instructions:
You may reply publicly to this message via plain-text email
using any one of the following methods:
* Save the following mbox file, import it into your mail client,
and reply-to-all from there: mbox
Avoid top-posting and favor interleaved quoting:
https://en.wikipedia.org/wiki/Posting_style#Interleaved_style
* Reply using the --to, --cc, and --in-reply-to
switches of git-send-email(1):
git send-email \
--in-reply-to=20030712060506.0b152432.lista1@telia.com \
--to=lista1@telia.com \
--cc=linux-kernel@vger.kernel.org \
/path/to/YOUR_REPLY
https://kernel.org/pub/software/scm/git/docs/git-send-email.html
* If your mail client supports setting the In-Reply-To header
via mailto: links, try the mailto: link
Be sure your reply has a Subject: header at the top and a blank line
before the message body.
This is a public inbox, see mirroring instructions
for how to clone and mirror all data and code used for this inbox
all inboxes | Powered by JetHome®